PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_9338_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 166aa    MW: 19636.3 Da    PI: 10.1672
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_9338_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.23.8e-084082347
                                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                     Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                        +WT +E+e +  a +q G++ +++I  +++  +   q++++++ +
  cra_locus_9338_iso_3_len_495_ver_3 40 AWTHQEEESFFSALRQVGKN-FEKITCRVQ-SKNKDQVRHYYYRL 82
                                        6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.2E-103287IPR009057Homeodomain-like
PROSITE profilePS5129312.4583687IPR017884SANT domain
SMARTSM007176.0E-43785IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.9E-63885IPR009057Homeodomain-like
CDDcd001674.63E-44083No hitNo description
PfamPF002493.0E-64082IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
XGLHPENVVI VDGASGASKS LQDHAAPQQP VKKQTRQWAA WTHQEEESFF SALRQVGKNF  60
EKITCRVQSK NKDQVRHYYY RLVRRMNKLL GPELWLDAKN SKDTNAAMLR WWSLLEKYSC  120
KASKLHLKPR RFKLIVETLV CLFYILCMIF LNETFHFHSI YIFMHX
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008387567.11e-75PREDICTED: TSL-kinase interacting protein 1-like
RefseqXP_011077326.12e-75PREDICTED: TSL-kinase interacting protein 1
SwissprotQ8LJT86e-67TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLD7TQP71e-73D7TQP7_VITVI; Putative uncharacterized protein
STRINGVIT_08s0040g01460.t013e-73(Vitis vinifera)